PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g04050.1.p
Common NameBRADI_4g04050, LOC100839870
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 242aa    MW: 27980.7 Da    PI: 8.3573
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g04050.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding568.8e-181057148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT++Ed++lv+ v+++G ++W+ Ia+  g++Rt+k+c++rw +yl
  Bradi4g04050.1.p 10 KGPWTEQEDLQLVCTVRLFGERRWDFIAKVSGLNRTGKSCRLRWVNYL 57
                      79********************************************97 PP

2Myb_DNA-binding54.62.6e-1763108148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rgr+T+ E+ l++++++++G++ W++Iar+++ gRt++++k++w++++
  Bradi4g04050.1.p  63 RGRMTAHEERLILELHARWGNR-WSRIARRLP-GRTDNEIKNYWRTHM 108
                       89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.259557IPR017930Myb domain
SMARTSM007171.9E-15959IPR001005SANT/Myb domain
SuperFamilySSF466894.49E-299104IPR009057Homeodomain-like
PfamPF002491.7E-161057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-201164IPR009057Homeodomain-like
CDDcd001673.02E-111257No hitNo description
PROSITE profilePS5129425.53958112IPR017930Myb domain
SMARTSM007172.6E-1662110IPR001005SANT/Myb domain
PfamPF002497.9E-1563107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2365111IPR009057Homeodomain-like
CDDcd001671.27E-1165108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MVTVREETRK GPWTEQEDLQ LVCTVRLFGE RRWDFIAKVS GLNRTGKSCR LRWVNYLHPG  60
LKRGRMTAHE ERLILELHAR WGNRWSRIAR RLPGRTDNEI KNYWRTHMRK KAQERKRSMS  120
PSSSSSSLTY QSCNPETPSI TGIDEQELHG GSNCITSILK GMPVDMDGYL MDQIWMEIEA  180
PEAPSEPSFH DGKDNLYNSA SGPLLPSPMW DYYCTEPRWK TDDDIKMAPQ FGYSKGMDPC  240
Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-2871121105MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-27711255159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-27711255159MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-28101124105C-Myb DNA-Binding Domain
1msf_C3e-28101124105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010237138.10.0PREDICTED: myb-related protein MYBAS2-like
SwissprotQ4JL761e-138MYBA2_ORYSJ; Myb-related protein MYBAS2
TrEMBLI1IHB00.0I1IHB0_BRADI; Uncharacterized protein
STRINGBRADI4G04050.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.31e-71myb domain protein 59